Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries) Uniprot Q5SLV5 1-137 |
Domain d1wkjb1: 1wkj B:1-137 [120984] automatically matched to 1WKJ A:1-137 |
PDB Entry: 1wkj (more details), 2 Å
SCOP Domain Sequences for d1wkjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkjb1 d.58.6.1 (B:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl edaqreialffrpeell
Timeline for d1wkjb1: