SCOP 1.75: Domain d1wkjb1: 1wkj B:1-137

Lineage for d1wkjb1 (1wkj B:1-137)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Thermus thermophilus [TaxId:274] [143289] (3 PDB entries)
   Uniprot Q5SLV5 1-137

8. Domain d1wkjb1: 1wkj B:1-137 [120984]
   automatically matched to 1WKJ A:1-137

Details for d1wkjb1

PDB Entry: 1wkj, 2 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Thermus thermophilus HB8

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1wkjb1:

Sequence; same for both SEQRES and ATOM records:

>d1wkjb1 d.58.6.1 (B:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]}
mertfvmikpdgvrrglvgeilarferkgfriaalklmqisqelaerhyaehrekpffpg
lvrfitsgpvvamvlegpgvvaevrkmmgathpkdalpgtirgdfattidenvihgsatl
edaqreialffrpeell

Timeline for d1wkjb1:

• d1wkjb1 first appeared in SCOP 1.73
  
• d1wkjb1 is called d1wkjb_ in SCOPe 2.01
  
• d1wkjb1 appears in the current release, SCOPe 2.08, called d1wkjb_