![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (21 species) not a true protein |
![]() | Species Amphibacillus xylanus [TaxId:1449] [186822] (1 PDB entry) |
![]() | Domain d1we0j_: 1we0 J: [120939] Other proteins in same PDB: d1we0a1 automated match to d1n8ja_ complexed with nh4 |
PDB Entry: 1we0 (more details), 2.9 Å
SCOPe Domain Sequences for d1we0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we0j_ c.47.1.10 (J:) automated matches {Amphibacillus xylanus [TaxId: 1449]} sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
Timeline for d1we0j_: