Lineage for d1we0c_ (1we0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878082Species Amphibacillus xylanus [TaxId:1449] [186822] (1 PDB entry)
  8. 2878084Domain d1we0c_: 1we0 C: [120932]
    Other proteins in same PDB: d1we0a1
    automated match to d1n8ja_
    complexed with nh4

Details for d1we0c_

PDB Entry: 1we0 (more details), 2.9 Å

PDB Description: crystal structure of peroxiredoxin (ahpc) from amphibacillus xylanus
PDB Compounds: (C:) alkyl hydroperoxide reductase C

SCOPe Domain Sequences for d1we0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we0c_ c.47.1.10 (C:) automated matches {Amphibacillus xylanus [TaxId: 1449]}
sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc

SCOPe Domain Coordinates for d1we0c_:

Click to download the PDB-style file with coordinates for d1we0c_.
(The format of our PDB-style files is described here.)

Timeline for d1we0c_: