PDB entry 1we0

View 1we0 on RCSB PDB site
Description: Crystal structure of peroxiredoxin (AhpC) from Amphibacillus xylanus
Class: oxidoreductase
Keywords: Peroxiredoxin, AhpC, OXIDOREDUCTASE
Deposited on 2004-05-21, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0a1
  • Chain 'B':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0b_
  • Chain 'C':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0c_
  • Chain 'D':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0d_
  • Chain 'E':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0e_
  • Chain 'F':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0f_
  • Chain 'G':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0g_
  • Chain 'H':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0h_
  • Chain 'I':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0i_
  • Chain 'J':
    Compound: alkyl hydroperoxide reductase C
    Species: Amphibacillus xylanus [TaxId:1449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1we0j_
  • Heterogens: NH4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1we0A (A:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0A (A:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1we0B (B:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0B (B:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1we0C (C:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0C (C:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1we0D (D:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0D (D:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1we0E (E:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0E (E:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1we0F (F:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0F (F:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1we0G (G:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0G (G:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1we0H (H:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0H (H:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1we0I (I:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0I (I:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1we0J (J:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
    ldivgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1we0J (J:)
    sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
    lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
    gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc