Lineage for d1w2sa1 (1w2s A:3-307)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007408Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2007681Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2007685Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2007686Species Human (Homo sapiens) [TaxId:9606] [48253] (17 PDB entries)
  8. 2007719Domain d1w2sa1: 1w2s A:3-307 [120604]
    Other proteins in same PDB: d1w2sa2, d1w2sb1, d1w2sb2
    automatically matched to d1ghqa_

Details for d1w2sa1

PDB Entry: 1w2s (more details)

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering
PDB Compounds: (A:) complement c3 precursor

SCOPe Domain Sequences for d1w2sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2sa1 a.102.4.4 (A:3-307) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqelnl
dvslq

SCOPe Domain Coordinates for d1w2sa1:

Click to download the PDB-style file with coordinates for d1w2sa1.
(The format of our PDB-style files is described here.)

Timeline for d1w2sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w2sa2