Lineage for d1w2sb1 (1w2s B:6-69)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260769Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2260770Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2260771Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2260967Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 2260968Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 2260977Domain d1w2sb1: 1w2s B:6-69 [120605]
    Other proteins in same PDB: d1w2sa1, d1w2sa2
    automatically matched to d1ly2a1

Details for d1w2sb1

PDB Entry: 1w2s (more details)

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering
PDB Compounds: (B:) complement receptor type 2 precursor,

SCOPe Domain Sequences for d1w2sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2sb1 g.18.1.1 (B:6-69) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
scgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpapk
cqyf

SCOPe Domain Coordinates for d1w2sb1:

Click to download the PDB-style file with coordinates for d1w2sb1.
(The format of our PDB-style files is described here.)

Timeline for d1w2sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w2sb2