SCOP 1.73: Domain d1w2sa1: 1w2s A:1-307

Lineage for d1w2sa1 (1w2s A:1-307)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.4: Complement components [48251] (2 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (3 PDB entries)

8. Domain d1w2sa1: 1w2s A:1-307 [120604]
   Other proteins in same PDB: d1w2sb1, d1w2sb2
   automatically matched to d1ghqa_

Details for d1w2sa1

PDB Entry: 1w2s

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering

PDB Compounds: (A:) complement c3 precursor

SCOP Domain Sequences for d1w2sa1:

Sequence; same for both SEQRES and ATOM records:

>d1w2sa1 a.102.4.4 (A:1-307) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdapsdhqel
nldvslq

Timeline for d1w2sa1:

• d1w2sa1 is new in SCOP 1.73
  
• d1w2sa1 appears in SCOP 1.75
  
• d1w2sa1 appears in the current release, SCOPe 2.08