SCOP 1.73: Domain d1w2sb2: 1w2s B:70-137

Lineage for d1w2sb2 (1w2s B:70-137)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
   Pfam PF00084

6. Protein Complement receptor 2, cr2 [64564] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)

8. Domain d1w2sb2: 1w2s B:70-137 [120606]
   Other proteins in same PDB: d1w2sa1
   automatically matched to d1ghqc2

Details for d1w2sb2

PDB Entry: 1w2s

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering

PDB Compounds: (B:) complement receptor type 2 precursor,

SCOP Domain Sequences for d1w2sb2:

Sequence; same for both SEQRES and ATOM records:

>d1w2sb2 g.18.1.1 (B:70-137) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvsvfple

Timeline for d1w2sb2:

• d1w2sb2 is new in SCOP 1.73
  
• d1w2sb2 appears in SCOP 1.75
  
• d1w2sb2 appears in the current release, SCOPe 2.08