Lineage for d1vymb1 (1vym B:1-126)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1041062Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1041084Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 1041105Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
    Uniprot P12004
  8. 1041110Domain d1vymb1: 1vym B:1-126 [120544]
    automatically matched to d1axca1

Details for d1vymb1

PDB Entry: 1vym (more details), 2.3 Å

PDB Description: native human pcna
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1vymb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vymb1 d.131.1.2 (B:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d1vymb1:

Click to download the PDB-style file with coordinates for d1vymb1.
(The format of our PDB-style files is described here.)

Timeline for d1vymb1: