Lineage for d1vymb1 (1vym B:1-126)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
    Uniprot P12004
  8. Domain d1vymb1: 1vym B:1-126 [120544]
    automated match to d1u7ba1

Details for d1vymb1

PDB Entry: 1vym (more details), 2.3 Å

PDB Description: native human pcna
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1vymb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vymb1 d.131.1.2 (B:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d1vymb1 are not available.

Timeline for d1vymb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vymb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vyma1, d1vyma2, d1vymc1, d1vymc2