SCOPe 2.05: Domain d1vrxa_: 1vrx A:

Lineage for d1vrxa_ (1vrx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Endocellulase E1 [51497] (1 species)

7. Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)

8. Domain d1vrxa_: 1vrx A: [120486]
   automated match to d1c0da_
   mutant

Details for d1vrxa_

PDB Entry: 1vrx, 2.4 Å

PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g

PDB Compounds: (A:) endocellulase e1 from a. cellulolyticus

SCOPe Domain Sequences for d1vrxa_:

Sequence; same for both SEQRES and ATOM records:

>d1vrxa_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv

Timeline for d1vrxa_:

• d1vrxa_ first appeared in SCOP 1.73, called d1vrxa1
  
• d1vrxa_ appears in SCOPe 2.04
  
• d1vrxa_ appears in SCOPe 2.06
  
• d1vrxa_ appears in the current release, SCOPe 2.08