Lineage for d1vrxa_ (1vrx A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Endocellulase E1 [51497] (1 species) Species Acidothermus cellulolyticus [TaxId:28049] [51498] (3 PDB entries) 
Domain d1vrxa_: 1vrx A: [120486]
automated match to d1c0da_
mutant
Details for d1vrxa_
PDB Entry: 1vrx (more details), 2.4 Å
PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g
PDB Compounds: (A:) endocellulase e1 from a. cellulolyticusSCOPe Domain Sequences for d1vrxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrxa_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv
SCOPe Domain Coordinates for d1vrxa_:
Click to download the PDB-style file with coordinates for d1vrxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vrxa_:
- d1vrxa_ first appeared in SCOP 1.73, called d1vrxa1
- d1vrxa_ appears in SCOPe 2.07
View in 3D
