Lineage for d1c0da_ (1c0d A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) 
Family c.1.8.3: beta-glycanases [51487] (22 proteins)
consist of a number of sequence families
Protein Endocellulase E1 [51497] (1 species) Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries) 
Domain d1c0da_: 1c0d A: [28815]
Details for d1c0da_
PDB Entry: 1c0d (more details), 2.4 Å
PDB Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g
SCOP Domain Sequences for d1c0da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0da_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv
SCOP Domain Coordinates for d1c0da_:
Click to download the PDB-style file with coordinates for d1c0da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c0da_:
- d1c0da_ first appeared (with stable ids) in SCOP 1.55
- d1c0da_ appears in SCOP 1.69
- d1c0da_ does not appear in SCOP 1.73
View in 3D
