Lineage for d1vrwb_ (1vrw B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2092030Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [186807] (1 PDB entry)
  8. 2092031Domain d1vrwb_: 1vrw B: [120485]
    Other proteins in same PDB: d1vrwa1
    automated match to d1uh5a_
    complexed with nai

Details for d1vrwb_

PDB Entry: 1vrw (more details), 2.4 Å

PDB Description: Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with nadh
PDB Compounds: (B:) enoyl-acyl carrier reductase

SCOPe Domain Sequences for d1vrwb_:

Sequence, based on SEQRES records: (download)

>d1vrwb_ c.2.1.2 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntnq
nknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsvas
fllsresraitgqtiyvdnglnimflpdd

Sequence, based on observed residues (ATOM records): (download)

>d1vrwb_ c.2.1.2 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
ygggmssakaalesdtrvlayhlgrnynirintisagplksraatainkytfidyaieys
ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd

SCOPe Domain Coordinates for d1vrwb_:

Click to download the PDB-style file with coordinates for d1vrwb_.
(The format of our PDB-style files is described here.)

Timeline for d1vrwb_: