SCOPe 2.04: Domain d1vrpb1: 1vrp B:8-102

Lineage for d1vrpb1 (1vrp B:8-102)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Pacific electric ray (Torpedo californica) [TaxId:7787] [81820] (1 PDB entry)

8. Domain d1vrpb1: 1vrp B:8-102 [120475]
   Other proteins in same PDB: d1vrpa2, d1vrpb2
   automated match to d1g0wa1
   complexed with adp, iom, mg, no3

Details for d1vrpb1

PDB Entry: 1vrp, 2.1 Å

PDB Description: The 2.1 Structure of T. californica Creatine Kinase Complexed with the Transition-State Analogue Complex, ADP-Mg 2+ /NO3-/Creatine

PDB Compounds: (B:) Creatine kinase, M chain

SCOPe Domain Sequences for d1vrpb1:

Sequence; same for both SEQRES and ATOM records:

>d1vrpb1 a.83.1.1 (B:8-102) Creatine kinase, N-domain {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
nkwklnysaaeefpdlskhnnhmakaltldiykklrdketpsgftlddiiqtgvdnpghp
fimtvgcvagdeecyevfkdlfdpviedrhggykp

Timeline for d1vrpb1:

• d1vrpb1 first appeared in SCOP 1.73
  
• d1vrpb1 appears in SCOPe 2.03
  
• d1vrpb1 appears in SCOPe 2.05
  
• d1vrpb1 appears in the current release, SCOPe 2.08