Class a: All alpha proteins [46456] (285 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Creatine kinase, N-domain [48036] (7 species) |
Species Pacific electric ray (Torpedo californica) [TaxId:7787] [81820] (1 PDB entry) |
Domain d1vrpa1: 1vrp A:12-102 [120473] Other proteins in same PDB: d1vrpa2, d1vrpb2 automated match to d1g0wa1 complexed with adp, iom, mg, no3 |
PDB Entry: 1vrp (more details), 2.1 Å
SCOPe Domain Sequences for d1vrpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrpa1 a.83.1.1 (A:12-102) Creatine kinase, N-domain {Pacific electric ray (Torpedo californica) [TaxId: 7787]} lnysaaeefpdlskhnnhmakaltldiykklrdketpsgftlddiiqtgvdnpghpfimt vgcvagdeecyevfkdlfdpviedrhggykp
Timeline for d1vrpa1: