![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Creatine kinase, N-domain [48036] (7 species) |
![]() | Species Pacific electric ray (Torpedo californica) [TaxId:7787] [81820] (2 PDB entries) |
![]() | Domain d1vrpb1: 1vrp B:8-102 [120475] Other proteins in same PDB: d1vrpa2, d1vrpb2 automated match to d1g0wa1 complexed with adp, iom, mg, no3 |
PDB Entry: 1vrp (more details), 2.1 Å
SCOPe Domain Sequences for d1vrpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrpb1 a.83.1.1 (B:8-102) Creatine kinase, N-domain {Pacific electric ray (Torpedo californica) [TaxId: 7787]} nkwklnysaaeefpdlskhnnhmakaltldiykklrdketpsgftlddiiqtgvdnpghp fimtvgcvagdeecyevfkdlfdpviedrhggykp
Timeline for d1vrpb1: