Lineage for d1vr7a_ (1vr7 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224456Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
    duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687
  4. 1224457Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families) (S)
  5. 1224475Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins)
    Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme
  6. 1224482Protein automated matches [190084] (1 species)
    not a true protein
  7. 1224483Species Thermotoga maritima [TaxId:2336] [186805] (1 PDB entry)
  8. 1224484Domain d1vr7a_: 1vr7 A: [120443]
    automated match to d1tlua_
    complexed with edo

Details for d1vr7a_

PDB Entry: 1vr7 (more details), 1.2 Å

PDB Description: crystal structure of s-adenosylmethionine decarboxylase proenzyme (tm0655) from thermotoga maritima at 1.2 a resolution
PDB Compounds: (A:) s-adenosylmethionine decarboxylase proenzyme

SCOPe Domain Sequences for d1vr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr7a_ d.156.1.2 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydeigip

SCOPe Domain Coordinates for d1vr7a_:

Click to download the PDB-style file with coordinates for d1vr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1vr7a_: