Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily) duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687 |
Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families) |
Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins) Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme |
Protein automated matches [190084] (1 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186805] (1 PDB entry) |
Domain d1vr7a_: 1vr7 A: [120443] automated match to d1tlua_ complexed with edo |
PDB Entry: 1vr7 (more details), 1.2 Å
SCOPe Domain Sequences for d1vr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vr7a_ d.156.1.2 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydeigip
Timeline for d1vr7a_: