SCOP 1.73: Domain d1vr7a1: 1vr7 A:2-118

Lineage for d1vr7a1 (1vr7 A:2-118)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
   duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687

4. Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (2 families)

5. Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (1 protein)
   Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme

6. Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111224] (3 PDB entries)

8. Domain d1vr7a1: 1vr7 A:2-118 [120443]
   automatically matched to d1tlua_
   complexed with edo

Details for d1vr7a1

PDB Entry: 1vr7, 1.2 Å

PDB Description: crystal structure of s-adenosylmethionine decarboxylase proenzyme (tm0655) from thermotoga maritima at 1.2 a resolution

PDB Compounds: (A:) s-adenosylmethionine decarboxylase proenzyme

SCOP Domain Sequences for d1vr7a1:

Sequence; same for both SEQRES and ATOM records:

>d1vr7a1 d.156.1.2 (A:2-118) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima [TaxId: 2336]}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

Timeline for d1vr7a1:

• d1vr7a1 is new in SCOP 1.73
  
• d1vr7a1 appears in SCOP 1.75
  
• d1vr7a1 appears in the current release, SCOPe 2.08, called d1vr7a_