Lineage for d1vqlv1 (1vql V:1-65)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979523Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1979524Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1979525Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1979566Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 1979574Domain d1vqlv1: 1vql V:1-65 [120296]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse

Details for d1vqlv1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: The structure of the transition state analogue "DCSN" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vqlv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqlv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vqlv1:

Click to download the PDB-style file with coordinates for d1vqlv1.
(The format of our PDB-style files is described here.)

Timeline for d1vqlv1: