Lineage for d1vql21 (1vql 2:1-49)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733645Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2733646Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2733647Protein Ribosomal protein L39e [48664] (1 species)
  7. 2733648Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2733659Domain d1vql21: 1vql 2:1-49 [144423]
    Other proteins in same PDB: d1vql11, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to 1VQ4 2:1-49
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vql21

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1vql21:

Sequence, based on SEQRES records: (download)

>d1vql21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1vql21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d1vql21:

Click to download the PDB-style file with coordinates for d1vql21.
(The format of our PDB-style files is described here.)

Timeline for d1vql21: