Lineage for d1vqlx1 (1vql X:7-88)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942215Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 2942216Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
    automatically mapped to Pfam PF01198
  5. 2942217Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 2942218Protein Ribosomal protein L31e [54577] (1 species)
  7. 2942219Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 2942230Domain d1vqlx1: 1vql X:7-88 [120298]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqly1, d1vqlz1
    automatically matched to d1ffku_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqlx1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1vqlx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqlx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1vqlx1:

Click to download the PDB-style file with coordinates for d1vqlx1.
(The format of our PDB-style files is described here.)

Timeline for d1vqlx1: