Lineage for d1vb9b1 (1vb9 B:1-120)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries)
  8. Domain d1vb9b1: 1vb9 B:1-120 [119948]
    Other proteins in same PDB: d1vb9a2, d1vb9a3, d1vb9b2, d1vb9b3
    automated match to d1jl8a1
    complexed with ca

    has additional insertions and/or extensions that are not grouped together

Details for d1vb9b1

PDB Entry: 1vb9 (more details), 2.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) complexed with transglycosylated product
PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1vb9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb9b1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOPe Domain Coordinates for d1vb9b1 are not available.

Timeline for d1vb9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vb9b2, d1vb9b3
View in 3D
Domains from other chains:
(mouse over for more information)
d1vb9a1, d1vb9a2, d1vb9a3