SCOPe 2.02: Domain d1v9qa_: 1v9q A:

Lineage for d1v9qa_ (1v9q A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (229 PDB entries)
   Uniprot P02185

8. Domain d1v9qa_: 1v9q A: [119893]
   automated match to d1j3fa_
   complexed with czm, mn3, po4

Details for d1v9qa_

PDB Entry: 1v9q, 1.45 Å

PDB Description: crystal structure of an artificial metalloprotein:mn(iii)(3,3'-me2- salophen)/apo-a71g myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1v9qa_:

Sequence; same for both SEQRES and ATOM records:

>d1v9qa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1v9qa_:

• d1v9qa_ first appeared in SCOP 1.73, called d1v9qa1
  
• d1v9qa_ appears in SCOPe 2.01
  
• d1v9qa_ appears in SCOPe 2.03
  
• d1v9qa_ appears in the current release, SCOPe 2.08