Lineage for d1v9qa_ (1v9q A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein Myoglobin [46469] (10 species)
  7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. Domain d1v9qa_: 1v9q A: [119893]
    automated match to d1j3fa_
    complexed with czm, mn3, po4

Details for d1v9qa_

PDB Entry: 1v9q (more details), 1.45 Å

PDB Description: crystal structure of an artificial metalloprotein:mn(iii)(3,3'-me2- salophen)/apo-a71g myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1v9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9qa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1v9qa_ are not available.

Timeline for d1v9qa_: