| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
| Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
| Protein automated matches [190072] (18 species) not a true protein |
| Species Bacillus coagulans [TaxId:1398] [186792] (2 PDB entries) |
| Domain d1v53b_: 1v53 B: [119837] automated match to d2ayqb_ |
PDB Entry: 1v53 (more details), 2.85 Å
SCOPe Domain Sequences for d1v53b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v53b_ c.77.1.1 (B:) automated matches {Bacillus coagulans [TaxId: 1398]}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln
Timeline for d1v53b_: