Lineage for d1v53b_ (1v53 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1619980Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1620086Protein automated matches [190072] (18 species)
    not a true protein
  7. 1620095Species Bacillus coagulans [TaxId:1398] [186792] (2 PDB entries)
  8. 1620097Domain d1v53b_: 1v53 B: [119837]
    automated match to d2ayqb_

Details for d1v53b_

PDB Entry: 1v53 (more details), 2.85 Å

PDB Description: The crystal structure of 3-isopropylmalate dehydrogenase from Bacillus coagulans
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1v53b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v53b_ c.77.1.1 (B:) automated matches {Bacillus coagulans [TaxId: 1398]}
mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln

SCOPe Domain Coordinates for d1v53b_:

Click to download the PDB-style file with coordinates for d1v53b_.
(The format of our PDB-style files is described here.)

Timeline for d1v53b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v53a_