![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins) the active site is between the two identical subunits |
![]() | Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (9 species) |
![]() | Species Bacillus coagulans [TaxId:1398] [53664] (2 PDB entries) |
![]() | Domain d1v53b1: 1v53 B:1-356 [119837] automatically matched to d2ayqb_ |
PDB Entry: 1v53 (more details), 2.85 Å
SCOP Domain Sequences for d1v53b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v53b1 c.77.1.1 (B:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln
Timeline for d1v53b1: