Lineage for d1uzka2 (1uzk A:1605-1647)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031474Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 3031475Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 3031477Domain d1uzka2: 1uzk A:1605-1647 [119807]
    Other proteins in same PDB: d1uzka3
    automated match to d1uzpa2
    complexed with ca

Details for d1uzka2

PDB Entry: 1uzk (more details), 1.35 Å

PDB Description: integrin binding cbegf22-tb4-cbegf33 fragment of human fibrillin-1, ca bound to cbegf23 domain only
PDB Compounds: (A:) fibrillin-1

SCOPe Domain Sequences for d1uzka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
edidecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

SCOPe Domain Coordinates for d1uzka2:

Click to download the PDB-style file with coordinates for d1uzka2.
(The format of our PDB-style files is described here.)

Timeline for d1uzka2: