![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d1uywm_: 1uyw M: [119773] Other proteins in same PDB: d1uywl1, d1uywl2, d1uywn1, d1uywn2 automated match to d6shgh_ |
PDB Entry: 1uyw (more details), 2 Å
SCOPe Domain Sequences for d1uywm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uywm_ b.1.1.0 (M:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vqlqqsgpelvkpgtsvkiscktsgytfteytihwvkeaggkslawiggidpnsggtnys pnfkgkatltvdkssstaymdlrslssedsavyfcariyhydgyfdvwgagtavtvssak ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1uywm_: