![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d1uywl1: 1uyw L:1-107 [197579] Other proteins in same PDB: d1uywh_, d1uywl2, d1uywm_, d1uywn2 automated match to d1kcul1 |
PDB Entry: 1uyw (more details), 2 Å
SCOPe Domain Sequences for d1uywl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uywl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd rftgsgsatdftltissvqaedladyhcgqgysypytfgggtklelk
Timeline for d1uywl1:
![]() Domains from other chains: (mouse over for more information) d1uywh_, d1uywm_, d1uywn1, d1uywn2 |