Lineage for d1uywl1 (1uyw L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744282Domain d1uywl1: 1uyw L:1-107 [197579]
    Other proteins in same PDB: d1uywh_, d1uywl2, d1uywm_, d1uywn2
    automated match to d1kcul1

Details for d1uywl1

PDB Entry: 1uyw (more details), 2 Å

PDB Description: crystal structure of the antiflavivirus fab4g2
PDB Compounds: (L:) fab antibody light chain

SCOPe Domain Sequences for d1uywl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uywl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqgysypytfgggtklelk

SCOPe Domain Coordinates for d1uywl1:

Click to download the PDB-style file with coordinates for d1uywl1.
(The format of our PDB-style files is described here.)

Timeline for d1uywl1: