SCOPe 2.08: Domain d1uywh_: 1uyw H:

Lineage for d1uywh_ (1uyw H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d1uywh_: 1uyw H: [119772]
   Other proteins in same PDB: d1uywl1, d1uywl2, d1uywn1, d1uywn2
   automated match to d6shgh_

Details for d1uywh_

PDB Entry: 1uyw, 2 Å

PDB Description: crystal structure of the antiflavivirus fab4g2

PDB Compounds: (H:) fab antibody heavy chain

SCOPe Domain Sequences for d1uywh_:

Sequence; same for both SEQRES and ATOM records:

>d1uywh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgpelvkpgtsvkiscktsgytfteytihwvkeaggkslawiggidpnsggtnys
pnfkgkatltvdkssstaymdlrslssedsavyfcariyhydgyfdvwgagtavtvssak
ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1uywh_:

• d1uywh_ first appeared in SCOP 1.73, called d1uywh1
  
• d1uywh_ was called d1uywh1 in SCOPe 2.07