SCOPe 2.08: Domain d1uwav1: 1uwa V:150-475

Lineage for d1uwav1 (1uwa V:150-475)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)

8. Domain d1uwav1: 1uwa V:150-475 [119755]
   Other proteins in same PDB: d1uwaa2, d1uwab2, d1uwac_, d1uwae2, d1uwaf_, d1uwah2, d1uwai_, d1uwaj_, d1uwak2, d1uwam_, d1uwao2, d1uwap_, d1uwar2, d1uwat_, d1uwav2, d1uwaw_
   automated match to d1gk8a1
   complexed with cap, edo, mg; mutant

Details for d1uwav1

PDB Entry: 1uwa, 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas

PDB Compounds: (V:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uwav1:

Sequence; same for both SEQRES and ATOM records:

>d1uwav1 c.1.14.1 (V:150-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglflhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

Timeline for d1uwav1:

• d1uwav1 first appeared in SCOP 1.73
  
• d1uwav1 appears in SCOPe 2.07