SCOPe 2.08: Domain d1uwaf_: 1uwa F:

Lineage for d1uwaf_ (1uwa F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (7 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)

8. Domain d1uwaf_: 1uwa F: [119741]
   Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2
   automated match to d1ir21_
   complexed with cap, edo, mg; mutant

Details for d1uwaf_

PDB Entry: 1uwa, 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas

PDB Compounds: (F:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d1uwaf_:

Sequence; same for both SEQRES and ATOM records:

>d1uwaf_ d.73.1.1 (F:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankrsv

Timeline for d1uwaf_:

• d1uwaf_ first appeared in SCOP 1.73, called d1uwaf1
  
• d1uwaf_ appears in SCOPe 2.07