![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein automated matches [190066] (7 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries) |
![]() | Domain d1uwaw_: 1uwa W: [119757] Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 1uwa (more details), 2.3 Å
SCOPe Domain Sequences for d1uwaw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwaw_ d.73.1.1 (W:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpksardwqpankrsv
Timeline for d1uwaw_: