Lineage for d1uwaf_ (1uwa F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564399Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2564562Protein automated matches [190066] (7 species)
    not a true protein
  7. 2564563Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)
  8. 2564629Domain d1uwaf_: 1uwa F: [119741]
    Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d1uwaf_

PDB Entry: 1uwa (more details), 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas
PDB Compounds: (F:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d1uwaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwaf_ d.73.1.1 (F:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankrsv

SCOPe Domain Coordinates for d1uwaf_:

Click to download the PDB-style file with coordinates for d1uwaf_.
(The format of our PDB-style files is described here.)

Timeline for d1uwaf_: