SCOP 1.73: Domain d1ul1z2: 1ul1 Z:2-217

Lineage for d1ul1z2 (1ul1 Z:2-217)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (2 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142118] (1 PDB entry)

8. Domain d1ul1z2: 1ul1 Z:2-217 [119695]
   Other proteins in same PDB: d1ul1a1, d1ul1a2, d1ul1b1, d1ul1b2, d1ul1c1, d1ul1c2, d1ul1x1, d1ul1y1, d1ul1z1
   automatically matched to 1UL1 X:2-217
   complexed with mg

Details for d1ul1z2

PDB Entry: 1ul1, 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex

PDB Compounds: (Z:) Flap Endonuclease-1

SCOP Domain Sequences for d1ul1z2:

Sequence, based on SEQRES records:

>d1ul1z2 c.120.1.2 (Z:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqaqaagaeq
evekftkrlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmd
cltfgspvlmrhltaseakklpiqefhlsrilqelg

Sequence, based on observed residues (ATOM records):

>d1ul1z2 c.120.1.2 (Z:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]}
giqglakliadvapsairendiksyfgrkvaidasmsiyqfliavrqggdvlqneegett
shlmgmfyrtirmmengikpvyvfdgkppqlksgelakrserraeaekqlqqeqevekft
krlvkvtkqhndeckhllslmgipyldapseaeascaalvkagkvyaaatedmdcltfgs
pvlmrhltaseakklpiqefhlsrilqelg

Timeline for d1ul1z2:

• d1ul1z2 is new in SCOP 1.73
  
• d1ul1z2 appears in SCOP 1.75
  
• d1ul1z2 appears in the current release, SCOPe 2.08