SCOP 1.73: Domain d1ul1a1: 1ul1 A:1-126

Lineage for d1ul1a1 (1ul1 A:1-126)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)

8. Domain d1ul1a1: 1ul1 A:1-126 [119684]
   Other proteins in same PDB: d1ul1x1, d1ul1x2, d1ul1y1, d1ul1y2, d1ul1z1, d1ul1z2
   automatically matched to d1axca1
   complexed with mg

Details for d1ul1a1

PDB Entry: 1ul1, 2.9 Å

PDB Description: Crystal structure of the human FEN1-PCNA complex

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1ul1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ul1a1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d1ul1a1:

• d1ul1a1 is new in SCOP 1.73
  
• d1ul1a1 appears in SCOP 1.75
  
• d1ul1a1 appears in the current release, SCOPe 2.08