Lineage for d1u7sa_ (1u7s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978220Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (253 PDB entries)
    Uniprot P02185
  8. 1978271Domain d1u7sa_: 1u7s A: [119622]
    automated match to d104m__
    complexed with hem

Details for d1u7sa_

PDB Entry: 1u7s (more details), 1.4 Å

PDB Description: Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form 1)
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1u7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7sa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1u7sa_:

Click to download the PDB-style file with coordinates for d1u7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1u7sa_: