Lineage for d1u7sa1 (1u7s A:1-153)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632833Protein Myoglobin [46469] (9 species)
  7. 632918Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)
  8. 632932Domain d1u7sa1: 1u7s A:1-153 [119622]
    automatically matched to d1ufpa_
    complexed with hem

Details for d1u7sa1

PDB Entry: 1u7s (more details), 1.4 Å

PDB Description: Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form 1)
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1u7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7sa1 a.1.1.2 (A:1-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1u7sa1:

Click to download the PDB-style file with coordinates for d1u7sa1.
(The format of our PDB-style files is described here.)

Timeline for d1u7sa1: