![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries) |
![]() | Domain d1u6eb1: 1u6e B:-10-174 [119570] automated match to d2qnza1 complexed with cl; mutant |
PDB Entry: 1u6e (more details), 1.85 Å
SCOPe Domain Sequences for d1u6eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6eb1 c.95.1.2 (B:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa gaagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp fqgi
Timeline for d1u6eb1: