| Class b: All beta proteins [48724] (174 folds) | 
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands  | 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]()  | 
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) | 
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) | 
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries) probably orthologous to the human HLA-DQ group  | 
| Domain d1u3hc1: 1u3h C:82-181 [119510] Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc2, d1u3hd1, d1u3hd2, d1u3he_, d1u3hf_, d1u3hg2, d1u3hh1, d1u3hh2 automatically matched to d1k2da1  | 
PDB Entry: 1u3h (more details), 2.42 Å
SCOPe Domain Sequences for d1u3hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3hc1 b.1.1.2 (C:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1u3hc1: