Lineage for d1u3hd2 (1u3h D:4-93)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021417Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1021491Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (5 PDB entries)
  8. 1021494Domain d1u3hd2: 1u3h D:4-93 [119513]
    Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc1, d1u3hc2, d1u3hd1, d1u3he_, d1u3hf_, d1u3hg1, d1u3hg2, d1u3hh1
    automatically matched to d1f3jb2

Details for d1u3hd2

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
PDB Compounds: (D:) H-2 class II histocompatibility antigen, A-U beta chain

SCOPe Domain Sequences for d1u3hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3hd2 d.19.1.1 (D:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynk
qylertraeldtvcrynyeetevptslrr

SCOPe Domain Coordinates for d1u3hd2:

Click to download the PDB-style file with coordinates for d1u3hd2.
(The format of our PDB-style files is described here.)

Timeline for d1u3hd2: