Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Cytohesin 3 [141397] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141398] (1 PDB entry) Uniprot O08967 261-387 |
Domain d1u2ba1: 1u2b A:261-387 [119474] complexed with so4 |
PDB Entry: 1u2b (more details), 1.8 Å
SCOPe Domain Sequences for d1u2ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2ba1 b.55.1.1 (A:261-387) Cytohesin 3 {Mouse (Mus musculus) [TaxId: 10090]} tffnpdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsireve dprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasi srdpfyd
Timeline for d1u2ba1: