Lineage for d1u2ba1 (1u2b A:261-387)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803125Protein Cytohesin 3 [141397] (1 species)
  7. 2803126Species Mouse (Mus musculus) [TaxId:10090] [141398] (1 PDB entry)
    Uniprot O08967 261-387
  8. 2803127Domain d1u2ba1: 1u2b A:261-387 [119474]
    complexed with so4

Details for d1u2ba1

PDB Entry: 1u2b (more details), 1.8 Å

PDB Description: Triglycine variant of the Grp1 Pleckstrin Homology Domain unliganded
PDB Compounds: (A:) Cytohesin 3

SCOPe Domain Sequences for d1u2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ba1 b.55.1.1 (A:261-387) Cytohesin 3 {Mouse (Mus musculus) [TaxId: 10090]}
tffnpdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsireve
dprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasi
srdpfyd

SCOPe Domain Coordinates for d1u2ba1:

Click to download the PDB-style file with coordinates for d1u2ba1.
(The format of our PDB-style files is described here.)

Timeline for d1u2ba1: