SCOP 1.73: Domain d1u2ba1: 1u2b A:261-387

Lineage for d1u2ba1 (1u2b A:261-387)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
   Pfam PF00169

6. Protein Cytohesin 3 [141397] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141398] (1 PDB entry)

8. Domain d1u2ba1: 1u2b A:261-387 [119474]
   complexed with so4

Details for d1u2ba1

PDB Entry: 1u2b, 1.8 Å

PDB Description: Triglycine variant of the Grp1 Pleckstrin Homology Domain unliganded

PDB Compounds: (A:) Cytohesin 3

SCOP Domain Sequences for d1u2ba1:

Sequence; same for both SEQRES and ATOM records:

>d1u2ba1 b.55.1.1 (A:261-387) Cytohesin 3 {Mouse (Mus musculus) [TaxId: 10090]}
tffnpdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsireve
dprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasi
srdpfyd

Timeline for d1u2ba1:

• d1u2ba1 is new in SCOP 1.73
  
• d1u2ba1 appears in SCOP 1.75
  
• d1u2ba1 appears in the current release, SCOPe 2.08