Lineage for d1u0ob_ (1u0o B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001723Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)
  8. 3001727Domain d1u0ob_: 1u0o B: [119410]
    Other proteins in same PDB: d1u0oa_, d1u0oc1
    automated match to d1fvub_

Details for d1u0ob_

PDB Entry: 1u0o (more details), 2.7 Å

PDB Description: The mouse von Willebrand Factor A1-botrocetin complex
PDB Compounds: (B:) Botrocetin

SCOPe Domain Sequences for d1u0ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ob_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

SCOPe Domain Coordinates for d1u0ob_:

Click to download the PDB-style file with coordinates for d1u0ob_.
(The format of our PDB-style files is described here.)

Timeline for d1u0ob_: