SCOP 1.73: Domain d1u0ob1: 1u0o B:201-325

Lineage for d1u0ob1 (1u0o B:201-325)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)

8. Domain d1u0ob1: 1u0o B:201-325 [119410]
   Other proteins in same PDB: d1u0oa1
   automatically matched to d1fvub_

Details for d1u0ob1

PDB Entry: 1u0o, 2.7 Å

PDB Description: The mouse von Willebrand Factor A1-botrocetin complex

PDB Compounds: (B:) Botrocetin

SCOP Domain Sequences for d1u0ob1:

Sequence; same for both SEQRES and ATOM records:

>d1u0ob1 d.169.1.1 (B:201-325) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Timeline for d1u0ob1:

• d1u0ob1 is new in SCOP 1.73
  
• d1u0ob1 appears in SCOP 1.75
  
• d1u0ob1 appears in the current release, SCOPe 2.08, called d1u0ob_