Lineage for d1u0oc1 (1u0o C:507-702)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892325Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 2892338Species Mouse (Mus musculus) [TaxId:10090] [159676] (1 PDB entry)
    Uniprot Q8CIZ8 1270-1465
  8. 2892339Domain d1u0oc1: 1u0o C:507-702 [144382]
    Other proteins in same PDB: d1u0oa_, d1u0ob_

Details for d1u0oc1

PDB Entry: 1u0o (more details), 2.7 Å

PDB Description: The mouse von Willebrand Factor A1-botrocetin complex
PDB Compounds: (C:) von willebrand factor

SCOPe Domain Sequences for d1u0oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0oc1 c.62.1.1 (C:507-702) von Willebrand factor A1 domain, vWA1 {Mouse (Mus musculus) [TaxId: 10090]}
fycsklldlvflldgssmlseaefevlkafvvgmmerlhisqkrirvavveyhdgsrayl
elkarkrpselrritsqikytgsqvastsevlkytlfqifgkidrpeashitllltasqe
pprmarnlvryvqglkkkkvivipvgigphaslkqirliekqapenkafllsgvdeleqr
rdeivsylcdlapeap

SCOPe Domain Coordinates for d1u0oc1:

Click to download the PDB-style file with coordinates for d1u0oc1.
(The format of our PDB-style files is described here.)

Timeline for d1u0oc1: