Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [159676] (1 PDB entry) Uniprot Q8CIZ8 1270-1465 |
Domain d1u0oc1: 1u0o C:507-702 [144382] Other proteins in same PDB: d1u0oa_, d1u0ob_ |
PDB Entry: 1u0o (more details), 2.7 Å
SCOPe Domain Sequences for d1u0oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0oc1 c.62.1.1 (C:507-702) von Willebrand factor A1 domain, vWA1 {Mouse (Mus musculus) [TaxId: 10090]} fycsklldlvflldgssmlseaefevlkafvvgmmerlhisqkrirvavveyhdgsrayl elkarkrpselrritsqikytgsqvastsevlkytlfqifgkidrpeashitllltasqe pprmarnlvryvqglkkkkvivipvgigphaslkqirliekqapenkafllsgvdeleqr rdeivsylcdlapeap
Timeline for d1u0oc1: