![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Snake coagglutinin alpha chain [88861] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
![]() | Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries) |
![]() | Domain d1u0oa_: 1u0o A: [119409] Other proteins in same PDB: d1u0ob_, d1u0oc1 automated match to d1fvua_ |
PDB Entry: 1u0o (more details), 2.7 Å
SCOPe Domain Sequences for d1u0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0oa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc aqknpfvcksppp
Timeline for d1u0oa_: